PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.14419s0034.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 284aa    MW: 31702.4 Da    PI: 7.8695
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.14419s0034.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.13.1e-18129183256
                           T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           rk+ +++k+q   Lee F+++++++ +++  LAkkl+Lt rqV vWFqNrRa+ k
  Bostr.14419s0034.1.p 129 RKKLRLSKDQSAFLEETFKEHNTLNPKQKLALAKKLNLTARQVEVWFQNRRARTK 183
                           788899***********************************************98 PP

2HD-ZIP_I/II120.49.4e-39129218191
           HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                           +kk+rlsk+q+++LEe+F+e+++L+p++K +la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke  eLr 
  Bostr.14419s0034.1.p 129 RKKLRLSKDQSAFLEETFKEHNTLNPKQKLALAKKLNLTARQVEVWFQNRRARTKLKQTEVDCEYLKRCVEKLTEENRRLQKEAMELR- 216
                           69*************************************************************************************9. PP

           HD-ZIP_I/II  90 el 91 
                           +l
  Bostr.14419s0034.1.p 217 TL 218
                           44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046182.3E-23291IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.601.1E-18110186IPR009057Homeodomain-like
SuperFamilySSF466899.84E-19113186IPR009057Homeodomain-like
PROSITE profilePS5007117.313125185IPR001356Homeobox domain
SMARTSM003896.9E-16127189IPR001356Homeobox domain
CDDcd000862.32E-16129186No hitNo description
PfamPF000461.0E-15129183IPR001356Homeobox domain
PROSITE patternPS000270160183IPR017970Homeobox, conserved site
PfamPF021834.1E-8185218IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.1E-23185228IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009641Biological Processshade avoidance
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009826Biological Processunidimensional cell growth
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MMMGKEDLGL SLSLGFSQIH NPVQLNLNPN SSLSNNLQRF PWNQTFDPAS DLRKIDVNSF  60
PSTANCEEET GVSSPNSTIS STISGKRSER EGISGTGVGS GDDHDEITPD RGYSRGTSDE  120
DEDGGETSRK KLRLSKDQSA FLEETFKEHN TLNPKQKLAL AKKLNLTARQ VEVWFQNRRA  180
RTKLKQTEVD CEYLKRCVEK LTEENRRLQK EAMELRTLKL SPQFYGQMTP PTTLIMCPSC  240
ERVAGPSSSN HHHNHRPVSI NPWVACAGQV AHGLNFEAMR PRS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127133SRKKLRL
2177185RRARTKLKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00550DAPTransfer from AT5G47370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4284500.0AF428450.1 Arabidopsis thaliana AT5g47370/MQL5_23 mRNA, complete cds.
GenBankAJ4311830.0AJ431183.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein HAT2 (hat2 gene).
GenBankAY0523240.0AY052324.1 Arabidopsis thaliana AT5g47370/MQL5_23 mRNA, complete cds.
GenBankAY0619040.0AY061904.1 Arabidopsis thaliana AT5g47370/MQL5_23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199548.10.0homeobox-leucine zipper protein HAT2
SwissprotP466010.0HAT2_ARATH; Homeobox-leucine zipper protein HAT2
TrEMBLD7MPU40.0D7MPU4_ARALL; Putative uncharacterized protein
STRINGAT5G47370.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15632690
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47370.11e-168Homeobox-leucine zipper protein 4 (HB-4) / HD-ZIP protein